You have no items in your shopping cart.
Cart summary
SPINK1 Protein, Mouse, Recombinant (His)
Catalog Number: orb1977023
| Catalog Number | orb1977023 |
|---|---|
| Category | Proteins |
| Description | Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. SPINK1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P09036. |
| Tag | N-6xHis |
| Purity | 98.00% |
| Protein Sequence | AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC |
| UniProt ID | P09036 |
| MW | 8.1 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Mouse |
| Biological Activity | Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. SPINK1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P09036. |
| Expression Region | 24-80 aa |
| Storage | -20°C |
| Note | For research use only |
