SPIC Rabbit Polyclonal Antibody

• Catalog Number: orb576456
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SPIC
• Target: SPIC
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SPIC
• Protein Sequence: Synthetic peptide located within the following region: MTCCIDQDSLGQTFQDAIDILIQQSAGESQYSSENRNYMAIINPYPHVRG
• UniProt ID: Q6P3D7
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: P, Sp, Prf, Spi-C, C76795, AU019198
• Research Area: Epigenetics & Chromatin, Stem Cell & Developmental
• Note: For research use only
• NCBI: NP_035591

WB Suggested Anti-SPIC Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:312500, Positive Control: SP2/0 cell lysate.