You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292135 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SP100. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN |
Tested applications | ELISA, WB |
Clone Number | 1G6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003104 |
Detection limit for recombinant GST tagged SP100 is 0.03 ng/ml as a capture antibody.
Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody (M02), clone 1G6. Lane 1: SP100 transfected lysate (100.417 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of SP100 over-expressed 293 cell line, cotransfected with SP100 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP100 monoclonal antibody (M02), clone 1G6 (Cat # orb2292135). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (36.52 KDa).