SP100 monoclonal antibody (M02), clone 1G6

• Catalog Number: orb2292135
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SP100.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
• Tested applications: ELISA, WB
• Clone Number: 1G6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_003104

Detection limit for recombinant GST tagged SP100 is 0.03 ng/ml as a capture antibody.

Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody (M02), clone 1G6. Lane 1: SP100 transfected lysate (100.417 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of SP100 over-expressed 293 cell line, cotransfected with SP100 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP100 monoclonal antibody (M02), clone 1G6 (Cat # orb2292135). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.52 KDa).