SOX9 monoclonal antibody (M04), clone 3F11

• Catalog Number: orb2292142
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SOX9.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 3F11
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000337

Detection limit for recombinant GST tagged SOX9 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 1.5 ug/ml]

SOX9 monoclonal antibody (M04), clone 3F11 Western Blot analysis of SOX9 expression in HepG2.

Western Blot detection against Immunogen (37.84 KDa).