You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292143 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SOX9. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP |
Tested applications | ELISA, IF, IHC-P, IP, WB |
Clone Number | 3C10 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_000337 |
Detection limit for recombinant GST tagged SOX9 is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SOX9 on HepG2 cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to SOX9 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.7 ug/ml]
Immunoprecipitation of SOX9 transfected lysate using anti-SOX9 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SOX9 MaxPab rabbit polyclonal antibody.
SOX9 monoclonal antibody (M02), clone 3C10 Western Blot analysis of SOX9 expression in HepG2.
Western Blot analysis of SOX9 expression in transfected 293T cell line by SOX9 monoclonal antibody (M02), clone 3C10. Lane 1: SOX9 transfected lysate (56.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.84 KDa).