You have no items in your shopping cart.
Cart summary
SOST Protein, Mouse, Recombinant (hFc)
Catalog Number: orb1977034
| Catalog Number | orb1977034 |
|---|---|
| Category | Proteins |
| Description | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
| Tag | C-hFc |
| Purity | 98.00% |
| MW | 50.1 kDa (predicted) |
| UniProt ID | Q99P68 |
| Protein Sequence | QGWQAFRNDATEVIPGLGEYPEPPPENNQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPGARGAKANQAELENAY |
| Expression System | HEK293 Cells |
| Biological Origin | Mouse |
| Biological Activity | Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. |
| Expression Region | 24-211 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
