SOHLH2 Rabbit Polyclonal Antibody

• Catalog Number: orb587821
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SOHLH2
• Target: SOHLH2
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOHLH2
• Protein Sequence: Synthetic peptide located within the following region: ALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENL
• UniProt ID: Q9NX45
• MW: 55kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: TEB1, SOSF2, SPATA28, bHLHe81
• Research Area: Cell Biology, Epigenetics & Chromatin, Protein Bio
• Note: For research use only

Sample Tissue: Human MDA-MB-435s Whole Cell, Antibody Dilution: 1 ug/ml.