You have no items in your shopping cart.
Cart summary
SOD1 Protein, Rat, Recombinant (His)
Catalog Number: orb1976542
| Catalog Number | orb1976542 |
|---|---|
| Category | Proteins |
| Description | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P07632. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 17.3 kDa (predicted) |
| UniProt ID | P07632 |
| Protein Sequence | AMKAVCVLKGDGPVQGVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGCTTAGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Rat |
| Biological Activity | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Rat, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 17.3 kDa and the accession number is P07632. |
| Expression Region | 2-154 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
