You have no items in your shopping cart.
Cart summary
SOD1 Protein, Mouse, Recombinant (E. coli, His)
Catalog Number: orb1977003
| Catalog Number | orb1977003 |
|---|---|
| Category | Proteins |
| Description | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.8 kDa and the accession number is P08228. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 19.8 kDa (predicted) |
| UniProt ID | P08228 |
| Protein Sequence | AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. SOD1 Protein, Mouse, Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.8 kDa and the accession number is P08228. |
| Expression Region | 2-154 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
