You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291792 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant SOCS3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Tested applications | ELISA, IF, IHC-P |
Clone Number | 1E4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH60858 |
Detection limit for recombinant GST tagged SOCS3 is approximately 3 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SOCS3 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to SOCS3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]