SOCS3 monoclonal antibody (M02), clone 1E4

• Catalog Number: orb2291792
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant SOCS3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E4
• Tested applications: ELISA, IF, IHC-P
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• NCBI: AAH60858
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SOCS3 is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SOCS3 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SOCS3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]