Cart summary

You have no items in your shopping cart.

SNX4 Peptide - C-terminal region

SNX4 Peptide - C-terminal region

Catalog Number: orb1998577

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998577
CategoryProteins
DescriptionSNX4 Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: TTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIE
UniProt IDO95219
MW33 kDa
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesATG24B
NoteFor research use only
NCBINP_003785.1