C1orf142 Rabbit Polyclonal Antibody

SKU: orb326254

Description

Rabbit polyclonal antibody to SNAP47

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Porcine, Rabbit, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf142
• Target: SNAP47
• Protein Sequence: Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA
• Molecular Weight: 51kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti DKFZp686M10160 antibody, anti FLJ12517 antibody, anti IMAGE3451454 antibody, anti SNAP-47 antibody, anti SVAP1 antibody, anti HEL170 antibody, anti C1orf142 antibody

WB Suggested Anti-C1orf142 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: PANC1 cell lysate.

Quick Database Links

Gene Symbol

SNAP47

UniProt

Q5SQN1

RefSeq (Protein):NP_444280