You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2051183 |
---|---|
Category | Proteins |
Description | SNAP29 Recombinant Protein (Human) |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 56 kDa |
UniProt ID | O95721 |
Protein Sequence | MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
Source | E.coli |
NCBI | NP_004773 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | CEDNIK;cerebral dysgenesis, neuropathy, ichthyosis Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
56 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
56 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
56 kDa | |
E.coli |
Filter by Rating