You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291737 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant SNAP29. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3E4-E6 |
Tested applications | ELISA, IF, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | SNAP29 (AAH09715, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
NCBI | AAH09715 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged SNAP29 is 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SNAP29 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot analysis of SNAP29 expression in transfected 293T cell line by SNAP29 monoclonal antibody (M01), clone 3E4-E6. Lane 1: SNAP29 transfected lysate (28.38 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (54.12 KDa).