SNAP29 monoclonal antibody (M01), clone 3E4-E6

• Catalog Number: orb2291737
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant SNAP29.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3E4-E6
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: SNAP29 (AAH09715, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
• NCBI: AAH09715
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SNAP29 is 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SNAP29 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of SNAP29 expression in transfected 293T cell line by SNAP29 monoclonal antibody (M01), clone 3E4-E6. Lane 1: SNAP29 transfected lysate (28.38 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (54.12 KDa).