SNAI2 monoclonal antibody (M04), clone 4D11

• Catalog Number: orb2292159
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SNAI2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4D11
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
• NCBI: NP_003059
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SNAI2 is 0.3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SNAI2 on HeLa cell. [antibody concentration 10 ug/ml]

SNAI2 monoclonal antibody (M04), clone 4D11 Western Blot analysis of SNAI2 expression in Hela S3 NE.

Western Blot detection against Immunogen (33.77 KDa).