You have no items in your shopping cart.
Cart summary
Snaclec rhodocytin subunit alpha Protein, Calloselasma rhodostoma, Recombinant (His & SUMO)
Catalog Number: orb1979590
| Catalog Number | orb1979590 |
|---|---|
| Category | Proteins |
| Description | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Snaclec rhodocytin subunit alpha Protein, Calloselasma rhodostoma, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 31.8 kDa and the accession number is Q9I841. |
| Tag | N-6xHis-SUMO |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 31.8 kDa (predicted) |
| UniProt ID | Q9I841 |
| Protein Sequence | GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY |
| Expression System | E. coli |
| Biological Origin | Calloselasma rhodostoma |
| Biological Activity | Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLC-gamma-2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha-2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Snaclec rhodocytin subunit alpha Protein, Calloselasma rhodostoma, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 31.8 kDa and the accession number is Q9I841. |
| Expression Region | 1-136 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
