SMYD3 Antibody

• Catalog Number: orb334626
• Category: Antibodies
• Description: SMYD3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Monkey
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Western blot, 0.1-0.5μg/ml, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 49097 MW
• UniProt ID: Q9H7B4
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Histone-lysine N-methyltransferase SMYD3;2.1.1.43;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SMYD3 using anti-SMYD3 antibody.Lane 1:HELA cell;2:COLO320 cell.

IHC analysis of SMYD3 using anti-SMYD3 antibody. SMYD3 was detected in a paraffin-embedded section of human intestinal cancer tissue.