SMURF 2/SMURF2 Antibody

• Catalog Number: orb334481
• Category: Antibodies
• Description: SMURF 2/SMURF2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human SMURF 2 (317-351aa DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 86196 MW
• UniProt ID: Q9HAU4
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: E3 ubiquitin-protein ligase SMURF2;hSMURF2;6.3.2.-
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SMURF2 using anti-SMURF2 antibody.Lane 1:SMMC cell.

WB analysis of SMURF2 using anti-SMURF2 antibody.Lane 1:rat testis tissue;2:rat pancreas tissue;3:rat stomach testis lysates;4:mouse testis tissue.5:mouse pancreas tissue.