SMC3 Antibody (monoclonal, 4C12)

• Catalog Number: orb443137
• Category: Antibodies
• Description: SMC3 Antibody (monoclonal, 4C12)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C12
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 142 kDa
• UniProt ID: Q9UQE7
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Structural maintenance of chromosomes protein 3; S
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SMC3 using anti-SMC3 antibody.Lane 1:human 293T cell; 2:human HeLa cell; 3:human MCF-7 cell; 4:human MDA-MB-453 cell; 5:rat thymus tissue; 6:rat liver tissue; 7:mouse thymus tissue; 8:mouse liver tissue.

IHC analysis of SMC3 using anti-SMC3 antibody.SMC3 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of SMC3 using anti-SMC3 antibody.SMC3 was detected in paraffin-embedded section of human intestinal cancer tissue.