You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292156 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SMARCD2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL |
Tested applications | ELISA, IF, WB |
Clone Number | 2B2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003068 |
Immunofluorescence of monoclonal antibody to SMARCD2 on HeLa cell. [antibody concentration 10 ug/ml]
SMARCD2 monoclonal antibody (M02), clone 2B2 Western Blot analysis of SMARCD2 expression in Hela S3 NE.
SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in NIH/3T3.
SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in PC-12.
SMARCD2 monoclonal antibody (M02), clone 2B2. Western Blot analysis of SMARCD2 expression in Raw 264.7.