SMAD2 monoclonal antibody (M05), clone 3G9

• Catalog Number: orb2292625
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SMAD2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2b Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SMAD2 (AAH25699, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 3G9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH25699

Detection limit for recombinant GST tagged SMAD2 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SMAD2 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SMAD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 5 ug/ml]

SMAD2 monoclonal antibody (M05), clone 3G9 Western Blot analysis of SMAD2 expression in Hela S3 NE.

Western Blot detection against Immunogen (36.63 KDa).