SMAD1 monoclonal antibody (M05), clone 1C7

• Catalog Number: orb2292626
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SMAD1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C7
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: SMAD1 (NP_005891, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE
• NCBI: NP_005891
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]

SMAD1 monoclonal antibody (M05), clone 1C7 Western Blot analysis of SMAD1 expression in Hela S3 NE.

Western Blot detection against Immunogen (37.84 KDa).