SLMAP monoclonal antibody (M08), clone 2A7

• Catalog Number: orb2291937
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SLMAP.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A7
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SLMAP (NP_009090, 677 a.a. ~ 784 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQEKQSITDELKQCKNNLKLLREKGNNKPW
• NCBI: NP_009090
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SLMAP is 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to SLMAP on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

SLMAP monoclonal antibody (M08), clone 2A7 Western Blot analysis of SLMAP expression in A-431.

Western Blot detection against Immunogen (37.62 KDa).