SLCO6A1 Rabbit Polyclonal Antibody

• Catalog Number: orb579062
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLCO6A1
• Target: SLCO6A1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLCO6A1
• Protein Sequence: Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS
• UniProt ID: Q86UG4
• MW: 79kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GST, CT48, OATPY, OATP-I, OATP6A1
• Research Area: Cell Biology
• Note: For research use only
• NCBI: NP_775759

WB Suggested Anti-SLCO6A1 Antibody Titration: 5.0 ug/ml, Positive Control: Jurkat cell lysate.