SLC7A8 monoclonal antibody (M01), clone 3F10

• Catalog Number: orb2291334
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SLC7A8.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3F10
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
• NCBI: NP_036376.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SLC7A8 is 0.3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (33.33 KDa).