You have no items in your shopping cart.
Cart summary
SLC7A5 Protein, Human, Recombinant (His & Myc & SUMO)
Catalog Number: orb1978311
| Catalog Number | orb1978311 |
|---|---|
| Category | Proteins |
| Description | SLC7A5 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 19.7 kDa and the accession number is Q01650. |
| Tag | N-10xHis-SUMO, C-Myc |
| Purity | 98.00% |
| MW | 19.7 kDa (predicted) |
| UniProt ID | Q01650 |
| Protein Sequence | AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | SLC7A5 Protein, Human, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10xHis-SUMO and C-Myc tag. The predicted molecular weight is 19.7 kDa and the accession number is Q01650. |
| Expression Region | 16-50 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
