SLC34A2 Antibody

• Catalog Number: orb546345
• Category: Antibodies
• Description: SLC34A2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SLC34A2 (QNWTMKNVTYKENIAKCQHIFVNFHLPDLA).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2 μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 76-130 kDa
• UniProt ID: O95436
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Sodium-dependent phosphate transport protein 2B; S
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Western blot analysis of human HEK293 whole cell lysates (Lane 1), human K562 whole cell lysates (Lane 2) using SLC34A2 antibody.

Immunohistochemical staining of human lung cancer tissue using SLC34A2 antibody.

Immunohistochemical staining of human lung cancer tissue using SLC34A2 antibody.

Immunohistochemical staining of mouse lung tissue using SLC34A2 antibody.

Immunohistochemical staining of rat lung tissue using SLC34A2 antibody.

Immunofluorescence analysis of A431 cell using SLC34A2 antibody.

Flow Cytometry analysis of SiHa cells using SLC34A2 antibody.