You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291754 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SLC33A1. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SLC33A1 (NP_004724, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFR |
Tested applications | ELISA, WB |
Clone Number | 3A4 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_004724 |
Detection limit for recombinant GST tagged SLC33A1 is 0.03 ng/ml as a capture antibody.
SLC33A1 monoclonal antibody (M07), clone 3A4 Western Blot analysis of SLC33A1 expression in PC-12.
Western Blot analysis of SLC33A1 expression in transfected 293T cell line by SLC33A1 monoclonal antibody (M07), clone 3A4. Lane 1: SLC33A1 transfected lysate (60.9 KDa). Lane 2: Non-transfected lysate.
Western blot analysis of SLC33A1 over-expressed 293 cell line, cotransfected with SLC33A1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SLC33A1 monoclonal antibody (M07), clone 3A4 (Cat # orb2291754). GAPDH (36.1 kDa) used as specificity and loading control.
Western Blot detection against Immunogen (33.33 KDa).