Cart summary

You have no items in your shopping cart.

SLC27A3 Rabbit Polyclonal Antibody (FITC)

SLC27A3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2119821

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2119821
CategoryAntibodies
DescriptionSLC27A3 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human SLC27A3
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW79kDa
UniProt IDQ5K4L6
Protein SequenceSynthetic peptide located within the following region: PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP
NCBINP_077306
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesFATP3, ACSVL3, VLCS-3
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.