SLC25A38 Rabbit Polyclonal Antibody

• Catalog Number: orb330355
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SLC25A38
• Target: SLC25A38
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC25A38
• Protein Sequence: Synthetic peptide located within the following region: VGIYFGTLYSLKQYFLRGHPPTALESVMLGVGSRSVAGVCMSPITVIKTR
• UniProt ID: Q96DW6
• MW: 34 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ20551 antibody, anti FLJ22703 antibody
• Note: For research use only
• NCBI: NP_060345

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.

Human Muscle

WB Suggested Anti-SLC25A38 Antibody Titration: 0.2-1 ug/mL, Positive Control: Jurkat cell lysate.