SLC22A5 Rabbit Polyclonal Antibody

SKU: orb585632

Description

Rabbit polyclonal antibody to SLC22A5

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of SLC22A5
• Target: SLC22A5
• Protein Sequence: Synthetic peptide located within the following region: TLFLPESFGTPLPDTIDQMLRVKGMKHRKTPSHTRMLKDGQERPTILKST
• Molecular Weight: 61kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CDSP, OCTN2

WB Suggested Anti-SLC22A5 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell. SLC22A5 is supported by BioGPS gene expression data to be expressed in HeLa.

Quick Database Links

Gene Symbol

SLC22A5

UniProt

O76082

RefSeq (Protein):NP_003051