SLC22A12 monoclonal antibody (M02), clone 2B5

• Catalog Number: orb2290687
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SLC22A12.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2B5
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: SLC22A12 (NP_653186.2, 281 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
• NCBI: NP_653186.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SLC22A12 is 0.3 ng/ml as a capture antibody.

SLC22A12 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SLC22A12 expression in human stomach.

Western Blot detection against Immunogen (33.33 KDa).