Cart summary

You have no items in your shopping cart.

SLC19A1 Peptide - N-terminal region

SLC19A1 Peptide - N-terminal region

Catalog Number: orb2003189

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2003189
CategoryProteins
DescriptionSLC19A1 Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: SWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITPVLS
UniProt IDP41440
MW65kDa
Tested applicationsWB
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesSLC19A1, FLOT1, RFC1,
NoteFor research use only
NCBIXP_005261220