You have no items in your shopping cart.
Cart summary
SLC17A6 Protein, Rat, Recombinant (His)
Catalog Number: orb1976520
| Catalog Number | orb1976520 |
|---|---|
| Category | Proteins |
| Description | Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. SLC17A6 Protein, Rat, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is Q9JI12. |
| Tag | C-6xHis |
| Purity | 98.00% |
| MW | 11.1 kDa (predicted) |
| UniProt ID | Q9JI12 |
| Protein Sequence | SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Rat |
| Biological Activity | Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. May also mediate the transport of inorganic phosphate. Involved in the regulation of retinal hyaloid vessel regression during postnatal development. May also play a role in the endocrine glutamatergic system of other tissues such as pineal gland and pancreas. SLC17A6 Protein, Rat, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 11.1 kDa and the accession number is Q9JI12. |
| Expression Region | 499-582 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
