You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
SLC13A2 polyclonal antibody (A01)
Catalog Number: orb2291780
| Catalog Number | orb2291780 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant SLC13A2. |
| Clonality | Polyclonal |
| Species/Host | Mouse |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | 50 % glycerol |
| Immunogen | SLC13A2 (NP_003975, 146 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQC |
| Tested applications | ELISA, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_003975 |
SLC13A2 polyclonal antibody (A01), Western Blot analysis of SLC13A2 expression in MCF-7.
Western Blot detection against Immunogen (34.36 KDa).
