SLC10A1 Antibody

• Catalog Number: orb316608
• Category: Antibodies
• Description: SLC10A1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, IF, IHC, IHC-Fr, WB
• Reactivity: Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse SLC10A1 (296-336aa EGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEK), different from the related human sequence by eighteen amino acids, and from the related rat sequence by three amino a
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat Immunohistochemistry (Frozen Section), 0.5-1μg/ml Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 39413 MW
• UniProt ID: O08705
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Sodium/bile acid cotransporter;Na (+)/bile acid co
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of HEPA1-6 cells using anti-SLC10A1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of SLC10A1 using anti-SLC10A1 antibody.Lane 1:rat liver tissue; 2:mouse liver tissue.

IF analysis of SLC10A1 using anti- SLC10A1 antibody. SLC10A1 was detected in paraffin-embedded section of mouse liver tissues.

IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in a paraffin-embedded section of mouse liver tissue.

IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in a paraffin-embedded section of rat liver tissue.

IHC analysis of SLC10A1 using anti-SLC10A1 antibody. SLC10A1 was detected in frozen section of mouse liver tissue.