SKA2 Antibody

• Catalog Number: orb614137
• Category: Antibodies
• Description: SKA2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: "Western blot, 0.25-0.5μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human"
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 20 kDa
• UniProt ID: Q8WVK7
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Spindle and kinetochore-associated protein 2; Prot
• Note: For research use only
• Application notes: "Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users." . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis using anti-SKA2 antibody.Lane 1:A431 cell, Lane 2:U2OS cell, Lane 3:PC-3 cell, Lane 4:HEK293 cell, Lane 5:HL-60 cell, Lane 6:K562 cell, Lane 7:Caco-2 cell, Lane 8:HeLa cell.

Flow Cytometry analysis of U20S cells using anti-SKA2 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of 293T cells using anti-SKA2 antibody(Blue line).Isotype control antibody (Green line) was rabbit IgG.Unlabelled sample (Red line) was also used as a control.