SIX4 monoclonal antibody (M07), clone 5E1

• Catalog Number: orb2291108
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SIX4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
• Tested applications: ELISA, IF, WB
• Clone Number: 5E1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_059116
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SIX4 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SIX4 on HeLa cell. [antibody concentration 10 ug/ml]

SIX4 monoclonal antibody (M07), clone 5E1 Western Blot analysis of SIX4 expression in Hela S3 NE.

Western Blot detection against Immunogen (37.73 KDa).