SIRT1 monoclonal antibody (M01), clone 7B7

• Catalog Number: orb2291337
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SIRT1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: SIRT1 (AAH12499, 456 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
• Tested applications: ELISA, IF, IHC-P, WB
• Clone Number: 7B7
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH12499

Detection limit for recombinant GST tagged SIRT1 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to SIRT1 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to SIRT1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 1 ug/ml]

SIRT1 monoclonal antibody (M01), clone 7B7 Western Blot analysis of SIRT1 expression in Hela S3 NE.

Western Blot detection against Immunogen (36.63 KDa).