You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2294812 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SIGLEC6. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2G6 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG2b Kappa |
Immunogen | SIGLEC6 (NP_001236, 371 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
NCBI | NP_001236 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of SIGLEC6 transfected lysate using anti-SIGLEC6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SIGLEC6 MaxPab rabbit polyclonal antibody.
Western Blot analysis of SIGLEC6 expression in transfected 293T cell line by SIGLEC6 monoclonal antibody (M02), clone 2G6. Lane 1: SIGLEC6 transfected lysate(48.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (34.87 KDa).