You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
SIGLEC6 monoclonal antibody (M02), clone 2G6
Catalog Number: orb2294812
| Catalog Number | orb2294812 |
|---|---|
| Category | Antibodies |
| Description | Mouse monoclonal antibody raised against a partial recombinant SIGLEC6. |
| Species/Host | Mouse |
| Clonality | Monoclonal |
| Clone Number | 2G6 |
| Tested applications | ELISA, IP, WB |
| Reactivity | Human |
| Isotype | IgG2b Kappa |
| Immunogen | SIGLEC6 (NP_001236, 371 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Conjugation | Unconjugated |
| Protein Sequence | KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK |
| NCBI | NP_001236 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | In 1x PBS, pH 7.4 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Immunoprecipitation of SIGLEC6 transfected lysate using anti-SIGLEC6 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SIGLEC6 MaxPab rabbit polyclonal antibody.
Western Blot analysis of SIGLEC6 expression in transfected 293T cell line by SIGLEC6 monoclonal antibody (M02), clone 2G6. Lane 1: SIGLEC6 transfected lysate(48.3 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (34.87 KDa).
