SIGLEC6 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2294814
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human SIGLEC6 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: SIGLEC6 (ENSP00000344064, 1 a.a. ~ 437 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK
• NCBI: ENSP00000344064
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of SIGLEC6 transfected lysate using anti-SIGLEC6 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with SIGLEC6 purified MaxPab mouse polyclonal antibody (B01P) (orb2294815).

SIGLEC6 MaxPab rabbit polyclonal antibody. Western Blot analysis of SIGLEC6 expression in A-431.

Western Blot analysis of SIGLEC6 expression in transfected 293T cell line by SIGLEC6 MaxPab polyclonal antibody. Lane 1: SIGLEC6 transfected lysate(48.3 KDa). Lane 2: Non-transfected lysate.