You have no items in your shopping cart.
Cart summary
SIGIRR Recombinant Protein (Mouse)
Catalog Number: orb2053039
| Catalog Number | orb2053039 |
|---|---|
| Category | Proteins |
| Description | SIGIRR Recombinant Protein (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 14.7 kDa |
| UniProt ID | Q9JLZ8 |
| Protein Sequence | MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH |
| Source | Yeast |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | AI256711;S;single Ig IL-1 receptor related protein Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Mouse Sigirr protein [orb383088]
Greater than 90% as determined by SDS-PAGE.
28.7 kDa
E.coli
20 μg, 100 μg, 1 mgMouse Sigirr protein [orb383127]
Greater than 90% as determined by SDS-PAGE.
14.7 kDa
Yeast
1 mg, 20 μg, 100 μg, 500 μgSIGIRR Recombinant Protein (Mouse) [orb2053037]
Greater than 90% as determined by SDS-PAGE.
14.7 kDa
Yeast
500 μgSIGIRR Recombinant Protein (Mouse) [orb2053038]
Greater than 90% as determined by SDS-PAGE.
14.7 kDa
Yeast
20 μgSIGIRR Recombinant Protein (Mouse) [orb2053141]
Greater than 90% as determined by SDS-PAGE.
28.7 kDa
E.coli
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
