SHP2/PTPN11 Antibody (monoclonal, 2E6)

• Catalog Number: orb527043
• Category: Antibodies
• Description: SHP2/PTPN11 Antibody (monoclonal, 2E6)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: Clone: 2E6
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG2b
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 70 kDa
• UniProt ID: Q06124
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Tyrosine-protein phosphatase non-receptor type 11;
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500μg/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-SHP2/PTPN11 antibody (Blue line).Isotype control antibody (Green line) was mouse IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis using anti-SHP2/PTPN11 antibody.Lane 1:HepG2 cell;2:Jurkat cell;3:human CCRF-CEM cell.4:K562 cell;5:human A549 cell;6:human CACO-2 cell;7:human HeLa cell;8:rat brain tissue;9:rat C6 cell;10:mouse brain tissue;11:mouse Neuro-2a cell.

IF analysis of SHP2/PTPN11 using anti-SHP2/PTPN11 antibody. SHP2/PTPN11 was detected in immunocytochemical section of U251 cells.

IHC analysis of SHP2/PTPN11 using anti SHP2/PTPN11 antibody. SHP2/PTPN11 was detected in paraffin-embedded section of human colon cancer tissue.

IHC analysis of SHP2/PTPN11 using anti SHP2/PTPN11 antibody. SHP2/PTPN11 was detected in paraffin-embedded section of human tonsil tissue.

IHC analysis of SHP2/PTPN11 using anti SHP2/PTPN11 antibody. SHP2/PTPN11 was detected in paraffin-embedded section of mouse brain tissue.

IHC analysis of SHP2/PTPN11 using anti SHP2/PTPN11 antibody. SHP2/PTPN11 was detected in paraffin-embedded section of rat brain tissue.