SHMT1 monoclonal antibody (M01), clone 4F9

• Catalog Number: orb2292182
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant SHMT1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4F9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: SHMT1 (NP_004160, 374 a.a. ~ 482 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EKVLEACSIACNKNTCPGDRSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGVRATLKEFKERLAGDKYQAAVQALREEVESFASLFPLPGLPD
• NCBI: NP_004160
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged SHMT1 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1 ug/ml]

Immunoperoxidase of monoclonal antibody to SHMT1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]

SHMT1 monoclonal antibody (M01), clone 4F9 Western Blot analysis of SHMT1 expression in HeLa.

Western Blot analysis of SHMT1 expression in transfected 293T cell line by SHMT1 monoclonal antibody (M01), clone 4F9. Lane 1: SHMT1 transfected lysate (53.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.73 KDa).