SHIP/INPP5D Antibody

• Catalog Number: orb412984
• Category: Antibodies
• Description: SHIP/INPP5D Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human SHIP (NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot,0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section),0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 145 kDa
• UniProt ID: Q92835
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Phosphatidylinositol 3,4,5-trisphosphate 5-phospha
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of SHIP using anti-SHIP antibody.Lane 1:human CCRF-CEM cell;2:human SW620 cell.

IHC analysis of SHIP using anti-SHIP antibody.SHIP was detected in paraffin-embedded section of human tonsil tissue.

IHC analysis of SHIP using anti-SHIP antibody.SHIP was detected in paraffin-embedded section of mouse spleen tissue.

IHC analysis of SHIP using anti-SHIP antibody.SHIP was detected in paraffin-embedded section of rat spleen tissue.