SH3GL1 Rabbit Polyclonal Antibody

SKU: orb330863

Description

Rabbit polyclonal antibody to SH3GL1

Research Area

Cancer, Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1
• Target: SH3GL1
• Protein Sequence: Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
• Molecular Weight: 41kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CNSA1 antibody, anti EEN antibody, anti MGC111371 antibody, anti SH3D2B antibody, anti SH3P8 antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

WB Suggested Anti-SH3GL1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

SH3GL1

UniProt

Q99961

RefSeq (Protein):NP_003016