SH3GL1 Rabbit Polyclonal Antibody

SKU: orb330863

Description

SH3GL1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SH3GL1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer, Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SH3GL1
• Target: SH3GL1
• Protein Sequence: Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
• Molecular Weight: 41kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CNSA1 antibody, anti EEN antibody, anti MGC111371 antibody, anti SH3D2B antibody, anti SH3P8 antibody

Quick Database Links

Gene Symbol

SH3GL1

UniProt

Q99961

RefSeq (Protein):NP_003016