SGCG Rabbit Polyclonal Antibody

SKU: orb330374

Description

SGCG Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of SGCG. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human SGCG. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SGCG
• Target: SGCG
• Protein Sequence: Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS
• Molecular Weight: 32kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti A4 antibody, anti DAGA4 antibody, anti DMDA antibody, anti DMDA1 antibody, anti LGMD2C antibody, anti MAM antibody, anti MGC130048 antibody, anti SCARMD2 antibody, anti SCG3 antibody, anti TYPE antibody

Quick Database Links

Gene Symbol

SGCG

UniProt

Q13326

RefSeq (Protein):NP_000222