You have no items in your shopping cart.
Cart summary
SFTPB Protein, Human, Recombinant
Catalog Number: orb1977938
| Catalog Number | orb1977938 |
|---|---|
| Category | Proteins |
| Description | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988. |
| Tag | Tag Free |
| Purity | 98.00% |
| MW | 8.7 kDa (predicted) |
| UniProt ID | P07988 |
| Protein Sequence | FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Human |
| Biological Activity | Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. SFTPB Protein, Human, Recombinant is expressed in yeast. The predicted molecular weight is 8.7 kDa and the accession number is P07988. |
| Expression Region | 201-279 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Human SFTPB protein [orb419270]
Greater than 90% as determined by SDS-PAGE.
24.7 kDa
in vitro E.coli expression system
20 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Human SFTPB protein [orb418979]
Greater than 90% as determined by SDS-PAGE.
8.7 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
Human SFTPB protein [orb595023]
Greater than 85% as determined by SDS-PAGE.
50.7 kDa
Baculovirus
1 mg, 20 μg, 100 μg SFTPB Protein, Human, Recombinant (His) [orb1953186]
98.00%
41.04 kDa (predicted); 45 kDa (reducing conditions)
100 μg
