Cart summary

You have no items in your shopping cart.

SFTPA1 Peptide - middle region

SFTPA1 Peptide - middle region

Catalog Number: orb1998061

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1998061
CategoryProteins
DescriptionSFTPA1 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW27 kDa
UniProt IDQ8IWL2
Protein SequenceSynthetic peptide located within the following region: PPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQS
NCBINP_001087239.2
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesSPA, PSAP, PSPA, SP-A, SPA1, PSP-A, SFTP1, SP-A1,
Read more...
NoteFor research use only
Expiration Date6 months from date of receipt.