You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292194 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant SFRS3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse, Rat |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | SFRS3 (NP_003008, 1 a.a. ~ 85 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEK |
Tested applications | ELISA, IF, WB |
Clone Number | 2D2 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003008 |
Detection limit for recombinant GST tagged SFRS3 is approximately 0.1 ng/ml as a capture antibody.
Immunofluorescence of monoclonal antibody to SFRS3 on HeLa cell. [antibody concentration 10 ug/ml]
SFRS3 monoclonal antibody (M08), clone 2D2 Western Blot analysis of SFRS3 expression in HeLa.
SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in NIH/3T3.
SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in PC-12.
SFRS3 monoclonal antibody (M08), clone 2D2. Western Blot analysis of SFRS3 expression in Raw 264.7.
Western Blot detection against Immunogen (35.09 KDa).